Helicobacter pylori Shi470: HPSH_04075 Help Entry HPSH_04075        CDS       T00742                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hps  Helicobacter pylori Shi470 Pathway hps01100   Metabolic pathways hps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPSH_04075    00074 Mycolic acid biosynthesis     HPSH_04075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPSH_04075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACD48250 UniProt:  B2UTR8 LinkDB All DBs Position 794256..794492 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggca caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaactaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system