KEGG   Helicobacter pylori Sat464: HPSAT_03905
Entry
HPSAT_03905       CDS       T01897                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00540  Lipopolysaccharide biosynthesis
hpt01100  Metabolic pathways
Module
hpt_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSAT_03905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpt01005]
    HPSAT_03905
Lipopolysaccharide biosynthesis proteins [BR:hpt01005]
 Lipid A
  HPSAT_03905
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADO05517
LinkDB
Position
779931..780944
AA seq 337 aa
MHNQTLSTKNPPYFTQLTIPKPDGVLSVHASALISLPNDNLLSAYFSGTKEGARDVKISA
NLFDSKINRWSEAFIILTKEELSHYSHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATS
KIYQLESALEPIHFKFVQKLSLSPFLNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLL
KFDKHNNPRELLRPNALNHQLQPSLTPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPM
LTNLKNLNDALNLINLNKELYLIHNPSDSSLRRKELLLSKLENSNSFKTLKILDKANEVS
YPSYSLNSHFIDIVYTYNRSHIKHIRFNMAYLKSLLK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcacaatcaaaccctttcaaccaaaaaccccccctatttcacacagctcactatccct
aaaccagatggcgttttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataac
cttttgagcgcttattttagcggcactaaagaaggggcaagggatgtgaaaatcagtgcg
aatctttttgacagcaagatcaatcgctggagcgaagccttcatcattttaaccaaagaa
gagctttctcattattcgcatgaatatatcaaaaaactaggtaaccccttgctttttttg
catgacgataaaattttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttct
aaaatctatcaacttgaaagcgctttagagccgattcactttaagtttgtgcaaaaactc
tctttaagcccttttttaaacttaagccatttgataaaaaataagcctttaaacaccact
gatggcgggtttatgctaccgctctatcacgaattagccacccaataccccttgttgttg
aaatttgacaaacacaataacccaagagagcttttaaggcccaatgccctaaaccaccag
ctccagccaagcctaaccccctttaaagactgcgctatcatggcgtttagaaaccattct
tttaaagatagcctcatgctagaaacctgtaaaacccccaccgcttggcaaaaacccatg
cttacgaatttgaaaaacttgaatgacgctttgaatttgatcaatttaaacaaagaattg
tatttgatccacaaccctagcgattcatcactgcgccgtaaagaactcttactttctaaa
ttagaaaactcaaactcttttaaaaccttaaaaattttagataaagcaaatgaagtgagt
tacccaagttatagtcttaattctcattttatagatattgtctatacctacaaccgctct
catatcaaacacatccgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system