Helicobacter pylori Cuz20: HPCU_03065 Help Entry HPCU_03065        CDS       T01894                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpu  Helicobacter pylori Cuz20 Pathway hpu01100   Metabolic pathways hpu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPCU_03065 (acpP)    00074 Mycolic acid biosynthesis     HPCU_03065 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPCU_03065 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADO03779 UniProt:  A0AB32X7R0 LinkDB All DBs Position complement(609973..610209) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcagca caagttacgccagaagcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system