Henckelia pumila: 140859861 Help Entry 140859861         CDS       T11037                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism hpum  Henckelia pumila Pathway hpum04136   Autophagy - other Brite KEGG Orthology (KO) [BR:hpum00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     140859861  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hpum04131]     140859861    04121 Ubiquitin system [BR:hpum04121]     140859861    03029 Mitochondrial biogenesis [BR:hpum03029]     140859861 Membrane trafficking [BR:hpum04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     140859861 Ubiquitin system [BR:hpum04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    140859861 Mitochondrial biogenesis [BR:hpum03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     140859861 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  140859861 NCBI-ProteinID:  XP_073118565 LinkDB All DBs Position 4:complement(145587692..145589792) Genome browser AA seq 90 aa AA seqDB search MASETRKVVVHLRATGDAPILKQAKFKIAGADKFVKVIDFLRRQLHRETLFVYVNSAFSP NPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgagacccgtaaagtggtagttcacctaagagcaaccggtgacgctccaatc ctcaagcaagctaaattcaagattgctggggctgacaagtttgtaaaagtgattgatttt cttcgtcgtcaacttcatagggaaactttgtttgtgtacgtgaacagtgccttctcgcca aatccagatgagttggtcatcgatctatataataacttcggttttgatggtaaattagtg gttaattatgcgtgctccatggcctggggttga

DBGET integrated database retrieval system