Henckelia pumila: 140872137 Help Entry 140872137         CDS       T11037                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hpum  Henckelia pumila Pathway hpum04145   Phagosome hpum04148   Efferocytosis hpum04620   Toll-like receptor signaling pathway hpum05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hpum00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     140872137    04148 Efferocytosis     140872137  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     140872137  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     140872137  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hpum04131]     140872137   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hpum04147]     140872137    04031 GTP-binding proteins [BR:hpum04031]     140872137 Membrane trafficking [BR:hpum04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     140872137  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     140872137   Macropinocytosis    Ras GTPases     140872137  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     140872137 Exosome [BR:hpum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140872137   Exosomal proteins of other body fluids (saliva and urine)    140872137   Exosomal proteins of colorectal cancer cells    140872137   Exosomal proteins of bladder cancer cells    140872137 GTP-binding proteins [BR:hpum04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     140872137 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  140872137 NCBI-ProteinID:  XP_073131002 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILSFSLISKASFENISKKWVPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPIMTAQGEELRKLIGAIAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKKKGHKACNIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggtttataaagtgtgtgactgtcggagatggtgccgtgggtaaaact tgcctgctcatttcttacaccagcaacacctttcctactgattacgtcccaactgtgttt gacaattttagtgccaatgttgtggtggatggaagcactgtgaatttaggattgtgggat actgcaggccaggaggattacaatagattaagaccattgagttaccgtggagctgatgtc tttattctttcattttcccttattagcaaggccagcttcgagaatatctccaagaagtgg gtacctgaattgaggcattatgctcctggagttccaataattctcgttggaacaaagctt gatcttcgtgaggataagcagttcttcgtagatcacccaggagcagttcccatcatgact gcacagggagaggagctgaggaagttgattggagcaattgcttatattgaatgtagtgct aaaacacaacagaatgtgaaagcagtgtttgatgcagctataaaagtcgtcctgcagcca ccaaagcaaaagaagaaaaagaagaagaagggtcataaagcttgcaatatattgtga

DBGET integrated database retrieval system