KEGG   Helicobacter pylori v225d: HPV225_0586
Entry
HPV225_0586       CDS       T01899                                 
Name
(GenBank) Hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00540  Lipopolysaccharide biosynthesis
hpv01100  Metabolic pathways
Module
hpv_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPV225_0586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpv01005]
    HPV225_0586
Lipopolysaccharide biosynthesis proteins [BR:hpv01005]
 Lipid A
  HPV225_0586
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADI34668
UniProt: D6XPH4
LinkDB
Position
complement(560016..561029)
AA seq 337 aa
MHNQTLSTKNPPYFTQLTIPKPNGALSVHASALISLPNDNLLSAYFSGTKEGARDVKVSA
NLFDSKINRWSEAFIILTKEELSYYSHEYIKKLGNPLLFLHNDKILLFVVGVSMGGWATS
KIYQLESALEPIRFRFVQKLSLSPFLNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLL
KFDKHNNPRELLRPNALNHQLQPSLTPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQKPM
LTNLKNLNDALNLINLNKELYLIHNPSDSSLRRKELLLSKLENSNSFKTLKILDKADEVS
YPSYSLNSHFIDIVYTYNRSHIKHIRFNMAYLKSLLK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcacaatcaaaccctttcaaccaaaaaccccccctatttcacacagctcactatccct
aaaccaaatggcgctttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataat
cttttgagcgcttattttagcggcactaaagaaggggcaagggatgtgaaagtcagcgcg
aatctttttgacagcaagatcaatcgctggagtgaagccttcatcattttaaccaaagaa
gagctttcttattattcgcatgaatatatcaaaaaactaggtaaccccttgctttttttg
cataacgataaaattttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttct
aaaatctatcaacttgaaagcgctttagagccgattcgctttaggtttgtgcaaaaactc
tctttaagcccttttttaaacttaagccatttgataaaaaataagcctttaaacaccact
gatggtgggtttatgctaccactctatcacgaattagccacccaataccccttattattg
aaatttgacaaacacaataacccaagagagcttttaaggcctaatgccctaaaccaccag
ctccagccaagcctaaccccctttaaagactgtgctgtcatggcgtttagaaaccattct
tttaaagatagcctcatgctagaaacctgtaaaacccccaccgcttggcaaaaacccatg
cttacgaatttgaaaaacttgaatgacgctttgaatttgatcaatttaaacaaagaattg
tatctgatccacaaccctagcgattcatcactgcgccgtaaagaactcttgctttctaaa
ttagaaaactcaaactcttttaaaaccttaaaaattttagataaagcggatgaagtgagt
tacccaagctatagtcttaattctcattttatagatattgtctatacctacaaccgctct
catatcaaacacatccgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system