Helicobacter pylori 26695: HP_0559 Help Entry HP_0559           CDS       T00008                                  Name (GenBank) acyl carrier protein (acpP)   KO K02078   acyl carrier protein Organism hpy  Helicobacter pylori 26695 Pathway hpy01100   Metabolic pathways hpy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HP_0559    00074 Mycolic acid biosynthesis     HP_0559   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HP_0559 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AAD07626 UniProt:  P56464 LinkDB All DBs Position complement(594037..594273) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAVQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIINVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggtg caagttacgccagaggcggaatttgtgaaggatttgggtgcagactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcatcaatgtgggcgatgtggtgaagtatattgaggataataaactggcttaa

DBGET integrated database retrieval system