KEGG   Helicobacter pylori 26695: HP_0580
Entry
HP_0580           CDS       T00008                                 
Name
(GenBank) predicted coding region HP0580
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00540  Lipopolysaccharide biosynthesis
hpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HP_0580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpy01005]
    HP_0580
Lipopolysaccharide biosynthesis proteins [BR:hpy01005]
 Lipid A
  HP_0580
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AAD07646
UniProt: O25303
LinkDB
Position
complement(610903..612021)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFMRNQTLVTQTPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIRNKPLSTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDSSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaatcataatgaagcgccaaacccccccctatgcttttatgcgcaatcaaacc
cttgttactcaaacccccccctatttcacacaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagctctttaatcagcttgcctaacgacaatcttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagtgcaaatctttttgacagc
aaaactaatcgctggagcgaagccttcattattttaaccaaagaagagctttctcattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataagaaataagcctttaagcaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccacgagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagattgcgctattatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaggaactctggctttctaaattagaaaactccaac
tcttttaaaaccttaaaagttttagataaagcgaatgaagtgagttacccaagctatagc
cttaatcctcattttatagatattgtctatacttataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatccctcctcaagtga

DBGET integrated database retrieval system