Helicobacter pylori 26695: HP_0588 Help Entry HP_0588           CDS       T00008                                  Name (GenBank) ferrodoxin-like protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hpy  Helicobacter pylori 26695 Pathway hpy00020   Citrate cycle (TCA cycle) hpy00720   Other carbon fixation pathways hpy01100   Metabolic pathways hpy01110   Biosynthesis of secondary metabolites hpy01120   Microbial metabolism in diverse environments hpy01200   Carbon metabolism hpy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hpy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HP_0588   09102 Energy metabolism    00720 Other carbon fixation pathways     HP_0588 Enzymes [BR:hpy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HP_0588 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_21 Fer4_9 Fer4_6 Fer4_16 Fer4_2 Fer4_4 Fer4_8 Fer4_13 Fer4_15 Fer4_17 Fer4_3 Motif Other DBs NCBI-ProteinID:  AAD07653 UniProt:  O25310 LinkDB All DBs Position 620219..620560 Genome browser AA seq 113 aa AA seqDB search MAKMSAPDGVAVWVNEDRCKGCDICVSVCPAGVLGMGIEKERVLGKVAKVAYPESCIGCV QCELHCPDFAIYVADRKDFKFAKVSKEAQERSEKVKANKYMLLEETILEGRDK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggctaaaatgagcgctccagatggggttgccgtttgggtgaatgaagacaggtgtaag ggttgtgatatttgcgtatcggtatgccctgctggggttcttggcatggggattgaaaaa gaaagggtgcttggaaaagtggccaaagtagcctacccagagagctgtatcggttgcgtg caatgcgagttgcactgcccggattttgcgatttatgtggctgacaggaaggatttcaaa ttcgctaaagtttctaaagaagcccaagaaagaagcgaaaaggttaaggccaataaatac atgctcttagaagagactattttagaagggagagacaaataa

DBGET integrated database retrieval system