Helicobacter pylori oki102: HPOKI102_04215 Help Entry HPOKI102_04215    CDS       T03182                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyb  Helicobacter pylori oki102 Pathway hpyb01100   Metabolic pathways hpyb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI102_04215    00074 Mycolic acid biosynthesis     HPOKI102_04215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI102_04215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN34802 LinkDB All DBs Position 854297..854533 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTLEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttaaatgtggatgcggcg caagttacgctagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gagttaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system