Helicobacter pylori oki128: HPOKI128_02655 Help Entry HPOKI128_02655    CDS       T03724                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyd  Helicobacter pylori oki128 Pathway hpyd01100   Metabolic pathways hpyd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI128_02655    00074 Mycolic acid biosynthesis     HPOKI128_02655   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI128_02655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN37456 LinkDB All DBs Position complement(510546..510782) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDATQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcaacg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system