Helicobacter pylori oki154: HPOKI154_02875 Help Entry HPOKI154_02875    CDS       T03725                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpye  Helicobacter pylori oki154 Pathway hpye01100   Metabolic pathways hpye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI154_02875    00074 Mycolic acid biosynthesis     HPOKI154_02875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI154_02875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN38891 LinkDB All DBs Position complement(557570..557806) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDATQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcaacg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system