Helicobacter pylori oki422: HPOKI422_04215 Help Entry HPOKI422_04215    CDS       T03726                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyf  Helicobacter pylori oki422 Pathway hpyf01100   Metabolic pathways hpyf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI422_04215    00074 Mycolic acid biosynthesis     HPOKI422_04215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI422_04215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN40581 LinkDB All DBs Position 854500..854736 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcaattgaatgtggatgcggcg caagttacgccagaggcggagtttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactggcttaa

DBGET integrated database retrieval system