Helicobacter pylori oki422: HPOKI422_05855 Help Entry HPOKI422_05855    CDS       T03726                                  Symbol porD Name (GenBank) ferredoxin   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism hpyf  Helicobacter pylori oki422 Pathway hpyf00010   Glycolysis / Gluconeogenesis hpyf00020   Citrate cycle (TCA cycle) hpyf00620   Pyruvate metabolism hpyf00640   Propanoate metabolism hpyf00650   Butanoate metabolism hpyf00680   Methane metabolism hpyf00720   Other carbon fixation pathways hpyf01100   Metabolic pathways hpyf01110   Biosynthesis of secondary metabolites hpyf01120   Microbial metabolism in diverse environments hpyf01200   Carbon metabolism hpyf01210   2-Oxocarboxylic acid metabolism Module hpyf_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:hpyf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     HPOKI422_05855 (porD)    00020 Citrate cycle (TCA cycle)     HPOKI422_05855 (porD)    00620 Pyruvate metabolism     HPOKI422_05855 (porD)    00640 Propanoate metabolism     HPOKI422_05855 (porD)    00650 Butanoate metabolism     HPOKI422_05855 (porD)   09102 Energy metabolism    00720 Other carbon fixation pathways     HPOKI422_05855 (porD)    00680 Methane metabolism     HPOKI422_05855 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     HPOKI422_05855 (porD) Enzymes [BR:hpyf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      HPOKI422_05855 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_10 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_8 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_4 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  AHN40841 LinkDB All DBs Position 1186604..1186996 Genome browser AA seq 130 aa AA seqDB search MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ WPQKQEKKKS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaagaacgcg caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagttacttcacc acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaaatta aagggcgtggattattctcattgtaagggctgtggcgtgtgcgtggatgtctgccccact aaccctaaatcgctatggatgtttgaagaacaaattgagcctgccaccgctctcactcaa tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system