Helicobacter pylori oki673: HPOKI673_02850 Help Entry HPOKI673_02850    CDS       T03727                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyg  Helicobacter pylori oki673 Pathway hpyg01100   Metabolic pathways hpyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI673_02850    00074 Mycolic acid biosynthesis     HPOKI673_02850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI673_02850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN41794 LinkDB All DBs Position complement(554793..555029) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDATQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcaacg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system