Helicobacter pylori oki828: HPOKI828_02855 Help Entry HPOKI828_02855    CDS       T03728                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyh  Helicobacter pylori oki828 Pathway hpyh01100   Metabolic pathways hpyh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI828_02855    00074 Mycolic acid biosynthesis     HPOKI828_02855   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI828_02855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN43234 LinkDB All DBs Position complement(556950..557186) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDATQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcaacg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system