Helicobacter pylori UM037: K750_05080 Help Entry K750_05080        CDS       T02659                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyi  Helicobacter pylori UM037 Pathway hpyi01100   Metabolic pathways hpyi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K750_05080    00074 Mycolic acid biosynthesis     K750_05080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K750_05080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGL69960 UniProt:  A0AB33Z5G4 LinkDB All DBs Position 586366..586602 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLP NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggca caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactaccttaa

DBGET integrated database retrieval system