Helicobacter pylori oki898: HPOKI898_04220 Help Entry HPOKI898_04220    CDS       T03729                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyj  Helicobacter pylori oki898 Pathway hpyj01100   Metabolic pathways hpyj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOKI898_04220    00074 Mycolic acid biosynthesis     HPOKI898_04220   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOKI898_04220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHN44946 LinkDB All DBs Position 857879..858115 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDATQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcaattgaatgtggatgcgacg caagttacgccagaggcggagtttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactggcttaa

DBGET integrated database retrieval system