Helicobacter pylori OK310: HPOK310_0874 Help Entry HPOK310_0874      CDS       T02542                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism hpyl  Helicobacter pylori OK310 Pathway hpyl00362   Benzoate degradation hpyl01100   Metabolic pathways hpyl01120   Microbial metabolism in diverse environments hpyl01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:hpyl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     HPOK310_0874    00622 Xylene degradation     HPOK310_0874    00621 Dioxin degradation     HPOK310_0874 Enzymes [BR:hpyl01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      HPOK310_0874 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase KAP_NTPase Tautomerase_2 Pacs-1 ATPase_2 AAA-ATPase_like Motif Other DBs NCBI-ProteinID:  BAM98302 LinkDB All DBs Position complement(943280..943486) Genome browser AA seq 68 aa AA seqDB search MPFINIKLVPENGGPTNEQKQQLIEGVSDLMVKVLNKNKASVVVIIDEVDSNNYGLGGES VHHLRQKN NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccgtttatcaatatcaagcttgtgccagaaaatggaggaccaacaaacgagcaaaaa cagcaattgattgaaggggtttcagatttgatggttaaggtgttaaacaaaaataaggct tctgttgtggtcattatagatgaggtggattctaataattatggtcttgggggcgagagc gtccatcatttgaggcaaaaaaactaa

DBGET integrated database retrieval system