KEGG   Helicobacter pylori OK310: HPOK310_1458
Entry
HPOK310_1458      CDS       T02542                                 
Symbol
petA
Name
(GenBank) ubiquinol cytochrome c oxidoreductase, Rieske 2Fe-2S subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
hpyl  Helicobacter pylori OK310
Pathway
hpyl00190  Oxidative phosphorylation
hpyl01100  Metabolic pathways
hpyl02020  Two-component system
hpyl04148  Efferocytosis
Module
hpyl_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HPOK310_1458 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPOK310_1458 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    HPOK310_1458 (petA)
Enzymes [BR:hpyl01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     HPOK310_1458 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N TAT_signal
Other DBs
NCBI-ProteinID: BAM98886
LinkDB
Position
1560587..1561090
AA seq 167 aa
MADIQRRDFLGMSLASVTAIGAIASLVAMKKTWDPLPSVVSAGFTTIDVANMQEGQFSTV
EWRGKPVYILKRSKKGGFNEKRDFKIGESVFTTAIQICTHLGCIPTYQDEEKGFLCPCHG
GRFTSDGVNIAGTPPPRPFDIPPFKIEGTKITFGEAGAEYKKMMAKA
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcagatattcaaaggcgtgattttttaggaatgagtcttgctagtgttacagctata
ggggctatagcgagtctagtagcgatgaaaaagacttgggatccgcttccaagcgttgtt
tcagccggttttacgaccatagatgtggcgaatatgcaagaagggcagttttccaccgtg
gaatggcgcgggaaaccggtctatattctcaagcgttctaaaaaagggggctttaatgaa
aagcgcgattttaaaattggcgagagcgtttttaccacagccattcaaatttgcacgcat
ttggggtgtatccccacttatcaagatgaagaaaaaggctttttatgcccatgccatggg
gggcgtttcacttctgatggcgtgaatattgccggcactccccctccacgcccttttgat
attccgccttttaaaattgaaggcactaagatcacttttggtgaagccggggctgaatac
aagaaaatgatggctaaagcgtaa

DBGET integrated database retrieval system