Helicobacter pylori OK113: HPOK113_0576 Help Entry HPOK113_0576      CDS       T02510                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyo  Helicobacter pylori OK113 Pathway hpyo01100   Metabolic pathways hpyo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPOK113_0576 (acpP)    00074 Mycolic acid biosynthesis     HPOK113_0576 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPOK113_0576 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAM96484 LinkDB All DBs Position complement(610803..611039) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTLEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttaaatgtggatgcggcg caagttacgctagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gagttaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system