KEGG   Helicobacter pylori SouthAfrica20: HPSA20_0595
Entry
HPSA20_0595       CDS       T02807                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpys  Helicobacter pylori SouthAfrica20
Pathway
hpys00540  Lipopolysaccharide biosynthesis
hpys01100  Metabolic pathways
Module
hpys_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpys00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSA20_0595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpys01005]
    HPSA20_0595
Lipopolysaccharide biosynthesis proteins [BR:hpys01005]
 Lipid A
  HPSA20_0595
SSDB
Motif
Pfam: BNR_2 OppC_N
Other DBs
NCBI-ProteinID: AGT73833
UniProt: T1UBM7
LinkDB
Position
complement(545488..546606)
AA seq 372 aa
MEHSRNRLKNTAFFVGLFVVLFFIAMTHQTPPYAFMHNQALVTETPPYFAQLTIPKPHDA
LSVHASTLISLPNGNLLSAYFSGTKEGAKDVKISANLFDGKSNRWGEAFILLTKEELSKN
AHEYIKKLGNPLLFLHNDKILLFVVGVSMGGWATSKIYQFESALEPIDFKFVQKLSLSPF
LNLSHLVRTKPLNTTDGGFVLPIYHELATQYPLLLKFDKHHNPRGLLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDHLMLETCKNPTTWQKVMPTNLKNLDDSLNLLNLNGSLYLIHN
PSDLSLRRKELLLSKLENTNSFQTLKILDKANEVSYPSSSLNPYFIDIVYTYNRSHIKHI
RFNMAYLNSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctgaaaaataccgctttttttgtggggctttttgtcgtt
ttattttttattgcaatgacacaccaaacccccccctacgcttttatgcacaatcaagcc
cttgttactgaaacccccccctattttgctcagctcactatccctaaaccccatgacgct
ttaagcgtacatgcaagcacgctaatcagcctacctaatggcaatctcttgagcgcttat
tttagcggcactaaagaaggggcaaaagatgtgaaaatcagcgctaatctttttgatggc
aaatccaatcgttggggtgaagctttcattcttttaaccaaagaagagctttccaaaaac
gcgcatgaatacatcaaaaaattgggtaatcccttacttttcttgcataacgataagatt
ttgttgtttgtcgtgggggtgagcatgggtgggtgggcaacttctaaaatctatcaattt
gagagcgctttagagccaattgatttcaaatttgtgcaaaaactctccctaagccctttt
ttaaacttgagccatttagtaaggactaaacccttaaacaccactgatggcgggtttgtg
ctgccgatctatcacgaattagccacgcaataccccttgttattgaaatttgacaaacac
cataacccaagagggcttttaaggccaaacgctttaaaccaccagctccagccaagcctg
accccctttaaagactgcgctatcatggcgtttagaaaccattcttttaaagatcacctc
atgctagaaacttgcaaaaaccccaccacttggcaaaaagtcatgcccacgaatttgaaa
aacttagacgattctttgaatttactcaatctaaacggatcgctatatctgatccataac
cctagcgatttgtccttacggcgtaaagaactcttgctttctaaattagaaaatacaaac
tcgtttcaaaccttaaaaattttggataaagccaatgaagtgagttacccaagctctagc
cttaatccttattttatagacattgtctatacctataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaattcccttctcaagtaa

DBGET integrated database retrieval system