Helicobacter pylori UM066: K751_03420 Help Entry K751_03420        CDS       T02660                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpyu  Helicobacter pylori UM066 Pathway hpyu01100   Metabolic pathways hpyu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpyu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K751_03420    00074 Mycolic acid biosynthesis     K751_03420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K751_03420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGL71259 LinkDB All DBs Position 950594..950830 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggca caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system