Helicobacter pylori 52: HPKB_0784 Help Entry HPKB_0784         CDS       T01898                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hpz  Helicobacter pylori 52 Pathway hpz01100   Metabolic pathways hpz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hpz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPKB_0784    00074 Mycolic acid biosynthesis     HPKB_0784   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPKB_0784 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACX99376 LinkDB All DBs Position 820850..821086 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttaaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system