Halomonas qinghailakensis: M0220_15040 Help Entry M0220_15040       CDS       T10463                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hqn  Halomonas qinghailakensis Pathway hqn01100   Metabolic pathways hqn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hqn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M0220_15040 (acpP)    00074 Mycolic acid biosynthesis     M0220_15040 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M0220_15040 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  UYO74175 UniProt:  A0AA46TPJ1 LinkDB All DBs Position 3317425..3317658 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgtgaagaaagttgtggcagagcgcctgaacgttaaagaa gaagacatccagaacagctcttcttttactgaagacctgggtgctgattctcttgacacc gttgaactggtgatggcacttgaagaggaatttgatactgaaattcctgatgaagaagcc gaaaaaatcactacggttcaagaagctatcgactacgtgaatgcccatcagtaa

DBGET integrated database retrieval system