Herbaspirillum rubrisubalbicans: Hrubri_1810 Help Entry Hrubri_1810       CDS       T04238                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hrb  Herbaspirillum rubrisubalbicans Pathway hrb01100   Metabolic pathways hrb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hrb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hrubri_1810 (acpP)    00074 Mycolic acid biosynthesis     Hrubri_1810 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hrubri_1810 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 MAP DUF1493 Motif Other DBs NCBI-ProteinID:  ALU89013 LinkDB All DBs Position 2101829..2102068 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKNESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYAKSQVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgcgtgaagaagatcgtcgctgagcaactgggcgtcgccgaa gccgacatcaagaacgaatcgtcgttcgtggacgacctgggcgccgactcgctggacacc gtcgagctggtcatggcactggaagatgagttcgaaatggaaatccccgacgaacaagcc gaaaagatcaccaccgtgcaacaggcgatcgactacgcaaagtcgcaagtcaaggcctga

DBGET integrated database retrieval system