Herbaspirillum rubrisubalbicans: Hrubri_3672 Help Entry Hrubri_3672       CDS       T04238                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hrb  Herbaspirillum rubrisubalbicans Pathway hrb01100   Metabolic pathways hrb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hrb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hrubri_3672    00074 Mycolic acid biosynthesis     Hrubri_3672   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hrubri_3672 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD DUF7885 Motif Other DBs NCBI-ProteinID:  ALU90829 LinkDB All DBs Position 4326392..4326670 Genome browser AA seq 92 aa AA seqDB search MTTLTSDMTKDEITVWIVDMLHEMFELDKASITPQSNLYTDLDIDSIDAVDIVVKLNQTT GKRIQPEVFRSVRTVQDVVEILAGLISEQAHA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccactctcacatctgacatgaccaaggacgaaatcaccgtgtggatcgtcgatatg ctgcacgagatgttcgagctcgacaaagccagcatcacgccccagtccaatctctatacc gacctggacatcgacagcatcgatgccgtggatatcgtcgtcaagctcaaccagaccacc ggcaagcgcatccaaccggaggtcttccgcagcgtgcgcacggtgcaggatgtggtggag atcctggccggcctgataagcgaacaggcgcacgcgtga

DBGET integrated database retrieval system