Halobaculum roseum: K6T36_12120 Help Entry K6T36_12120       CDS       T07547                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hre  Halobaculum roseum Pathway hre03010   Ribosome Brite KEGG Orthology (KO) [BR:hre00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K6T36_12120   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K6T36_12120  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hre03011]     K6T36_12120    04121 Ubiquitin system [BR:hre04121]     K6T36_12120 Ribosome [BR:hre03011]  Ribosomal proteins   Eukaryotes    Large subunit     K6T36_12120   Archaea     K6T36_12120 Ubiquitin system [BR:hre04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K6T36_12120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR zf-CHY Zn_Ribbon_1 DHHC Zn_ribbon_RPAB4 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  QZY02049 LinkDB All DBs Position complement(2391337..2391486) Genome browser AA seq 49 aa AA seqDB search MAQFDAAERRTLNKLICMRCNARNPQRAENCRKCGYGNLRPKAKEPRTA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctcaattcgacgcggccgagcgccgcacgctcaacaagctcatctgcatgcggtgc aacgctcgcaacccccagcgcgcggagaactgtcgcaagtgcggctacgggaacctccgc cccaaggcgaaggagccgcggaccgcataa

DBGET integrated database retrieval system