Haliotis rufescens (red abalone): 124112142 Help Entry 124112142         CDS       T07893                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism hrf  Haliotis rufescens (red abalone) Pathway hrf04814   Motor proteins Brite KEGG Orthology (KO) [BR:hrf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     124112142  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hrf03037]     124112142    04812 Cytoskeleton proteins [BR:hrf04812]     124112142 Cilium and associated proteins [BR:hrf03037]  Motile cilia and associated proteins   Dynein arm    124112142 Cytoskeleton proteins [BR:hrf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      124112142 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  124112142 NCBI-ProteinID:  XP_046328080 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDDFQSAEETSFVVDEVTNIIKEAIEGAIGGNAYQHNKVNQWTSNVVEQCLNQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSTDGSCTVRWENKMMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgattttcaatcagcagaagagacctcatttgttgttgatgaagtgacaaacatc atcaaagaggcaattgaaggagcgattggaggcaatgcctatcaacacaacaaagtgaac caatggacctccaatgttgtggagcaatgtctaaatcagcttacaaaactgggaaaaccc tttaagtacatagtgacttgtgtgatcatgcagaagaatggcgccggtctccacactgct agttcctgcttctgggacaactccactgatggtagctgcacagtgaggtgggagaacaag atgatgtactgcatcgtcagtgtcttcggcctcgccatctga

DBGET integrated database retrieval system