Haliotis rufescens (red abalone): 124122487 Help Entry 124122487         CDS       T07893                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism hrf  Haliotis rufescens (red abalone) Pathway hrf03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hrf00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     124122487  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hrf03036]     124122487    03400 DNA repair and recombination proteins [BR:hrf03400]     124122487 Chromosome and associated proteins [BR:hrf03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      124122487 DNA repair and recombination proteins [BR:hrf03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      124122487 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone DUF1465 TFIID-18kDa Motif Other DBs NCBI-GeneID:  124122487 NCBI-ProteinID:  XP_046341481 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MNVRDENVDDLSYEQRLKAAVHYTVVRICRDVGDDLNVSVNKQVMACIAETTWRQFETYS HDLEMFARHAKRSTVLPEDVKLLVRKSPKLLEHIHSLHRQLTANKEEPSRKKGARLNKKK SAAAAESNFETDENSNV NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgaatgtccgagatgaaaatgtggatgacctcagctatgaacagaggctgaaggcggca gtgcattacactgtggtgaggatatgtcgggatgttggggatgacctgaatgtctccgtc aacaagcaggtgatggcctgcattgcagagacaacatggagacagtttgagacctactct catgatctggagatgtttgcaaggcatgccaagcgcagcacagtgttaccggaagatgtg aagctgcttgtgaggaaaagtcccaaactgctggaacatatccactccctccacagacag ctcacagccaacaaggaggagcccagcaggaagaagggagccaggctgaacaagaagaag tccgcggctgcagcagaatctaactttgagaccgatgagaattccaatgtatag

DBGET integrated database retrieval system