Haliotis rufescens (red abalone): 124124287 Help Entry 124124287         CDS       T07893                                  Name (RefSeq) regucalcin-like isoform X1   KO K01053   gluconolactonase [EC:3.1.1.17] Organism hrf  Haliotis rufescens (red abalone) Pathway hrf00030   Pentose phosphate pathway hrf00053   Ascorbate and aldarate metabolism hrf01100   Metabolic pathways hrf01200   Carbon metabolism hrf01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hrf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     124124287    00053 Ascorbate and aldarate metabolism     124124287  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrf04147]     124124287 Enzymes [BR:hrf01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.17  gluconolactonase      124124287 Exosome [BR:hrf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124124287 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SGL Glu_cyclase_2 Mala_s_1-like Motif Other DBs NCBI-GeneID:  124124287 NCBI-ProteinID:  XP_048249921 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MTVDTEGKLWVACFDAGKVVRLDPETGKVIRTVKFTCEKITSCCFGGDDFTDLYVTSSKY LMTPAELEATPLAGSVFKVTGLGVRGRKANMFSG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccgttgatacggaggggaaattatgggtggcctgttttgacgctgggaaagttgtc cgactggaccccgagactggaaaagtgatccgaactgtcaagttcacatgtgaaaagata acttcctgttgttttggcggggacgacttcaccgacctctacgtcacatcatcgaaatac ctgatgaccccagcagaattggaggcaacaccattggctggctcagtcttcaaggtcacg gggctcggagtccgaggtcgcaaagctaacatgttttctggctaa

DBGET integrated database retrieval system