Haliotis rufescens (red abalone): 124134625 Help Entry 124134625         CDS       T07893                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism hrf  Haliotis rufescens (red abalone) Pathway hrf04081   Hormone signaling hrf04144   Endocytosis hrf04150   mTOR signaling pathway hrf04310   Wnt signaling pathway hrf04350   TGF-beta signaling pathway hrf04517   IgSF CAM signaling hrf04519   Cadherin signaling hrf05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hrf00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124134625    04350 TGF-beta signaling pathway     124134625    04150 mTOR signaling pathway     124134625   09133 Signaling molecules and interaction    04081 Hormone signaling     124134625    04517 IgSF CAM signaling     124134625    04519 Cadherin signaling     124134625  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124134625  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124134625  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrf04131]     124134625   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrf04147]     124134625    04031 GTP-binding proteins [BR:hrf04031]     124134625 Membrane trafficking [BR:hrf04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     124134625 Exosome [BR:hrf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124134625   Exosomal proteins of other body fluids (saliva and urine)    124134625   Exosomal proteins of colorectal cancer cells    124134625   Exosomal proteins of bladder cancer cells    124134625 GTP-binding proteins [BR:hrf04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     124134625 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 DUF3156 PduV-EutP DUF4443 AAA_22 Motif Other DBs NCBI-GeneID:  124134625 NCBI-ProteinID:  XP_046355516 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MGTEVKAIVVGDAGCGKSCLLLRFLKGHFITNDEAGSTFETGTSTVFVQGQKIELMVCDT GGSSMFDSLRQLSYNDGDVIVICYSITDRDSLQNVSERWRPEMLSHVTSDRPIVLVATKK DLRDSDLSFSSVRGSDKLHQEPVTTLEGQEMREKLDAVDFIECSAKQDDGVRELFQRVAE VGLESSRSRRKKICRQS NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgggtactgaggtcaaggctattgtggtgggcgacgcaggatgtgggaagtcatgcctg cttctccggttcttaaagggtcacttcatcaccaacgatgaagcagggtccacctttgag acgggcacttccaccgtctttgtgcaagggcagaagatagaactgatggtatgtgacacc ggcggaagcagcatgttcgacagcctgcgtcaactgtcctacaacgacggggacgtgata gtgatatgctactccatcactgaccgagactcgctgcagaacgtgtcggagagatggcgt ccagagatgctgagtcatgtcacctctgaccgcccgatcgtcctcgtggcaacgaagaag gaccttcgagactccgatctgtctttcagcagcgtccgtggcagcgacaagcttcatcag gagccggtgaccacccttgagggtcaagagatgagggaaaagctggacgccgtggacttc attgaatgctcggcaaaacaggacgacggtgtgcgcgagttgtttcagagagtggccgag gttggcctggagtctagtaggtcacggcgaaagaagatttgtcggcagtcgtga

DBGET integrated database retrieval system