Haliotis rufescens (red abalone): 124152446 Help Entry 124152446         CDS       T07893                                  Name (RefSeq) cdc42 homolog   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hrf  Haliotis rufescens (red abalone) Pathway hrf04145   Phagosome hrf04148   Efferocytosis hrf04310   Wnt signaling pathway hrf04620   Toll-like receptor signaling pathway hrf05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hrf00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124152446  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124152446    04148 Efferocytosis     124152446  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124152446  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124152446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrf04131]     124152446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrf04147]     124152446    04031 GTP-binding proteins [BR:hrf04031]     124152446 Membrane trafficking [BR:hrf04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124152446  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124152446   Macropinocytosis    Ras GTPases     124152446  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124152446 Exosome [BR:hrf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124152446   Exosomal proteins of other body fluids (saliva and urine)    124152446   Exosomal proteins of colorectal cancer cells    124152446   Exosomal proteins of bladder cancer cells    124152446 GTP-binding proteins [BR:hrf04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124152446 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf AAA_24 AAA_16 SIS Motif Other DBs NCBI-GeneID:  124152446 NCBI-ProteinID:  XP_046381338 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MVLEARNEKRIKCVVVGDDSIGKTSMLLGYATNRYPTQHVPSVFDNHAGSLKLAGRRIKL ELIDTVEEDERPIRKEIYEGTDIFVLCFSVVQPDSLQHVQDIWLPEIRQIAPEKPYILVG TQADLREVTTILRLLRTNGQKPISAAEGNTLARKLGATCYVEASPEVEKKVRRTINNALA SVLKVQDGSRDVQANVCTIL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggtgctagaggcgaggaacgagaaaaggattaaatgtgttgttgttggagatgattcc ataggcaagacgagcatgttattggggtatgcaacaaatcgctaccccacacagcacgta ccatccgtctttgacaaccacgcgggaagtctgaagctggcaggtcggcgaatcaagctg gagttgatagacacagtggaagaggatgagcggccgataaggaaagagatatacgaagga acagacattttcgtgctgtgtttctcggtagtccaaccggactctctacaacacgtgcag gacatatggttaccggaaatacgtcagatcgcaccggagaagccatatattctagtcgga acacaggccgatcttcgtgaagtgacgaccattctcagacttcttcgcacaaacggacag aaacctatctcagcggccgagggaaacaccctcgctcggaagttgggggccacgtgctat gtggaagcctcaccggaagtggagaaaaaggtgcgaaggactatcaataatgctcttgcg tctgtgcttaaagttcaagacggttcacgtgacgtacaagcaaatgtgtgtacaatattg taa

DBGET integrated database retrieval system