KEGG   Haliotis rubra (blacklip abalone): 124263967
Entry
124263967         CDS       T07967                                 
Name
(RefSeq) ADP-ribosylation factor-related protein 1-like
  KO
K07952  ADP-ribosylation factor related protein 1
Organism
hrj  Haliotis rubra (blacklip abalone)
Brite
KEGG Orthology (KO) [BR:hrj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hrj04131]
    124263967
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hrj04031]
    124263967
Membrane trafficking [BR:hrj04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    124263967
GTP-binding proteins [BR:hrj04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arp
    124263967
SSDB
Motif
Pfam: Arf G-alpha Roc Ras Gtr1_RagA SRPRB MMR_HSR1 RXYLT1_N HGTP_anticodon
Other DBs
NCBI-GeneID: 124263967
NCBI-ProteinID: XP_046554652
LinkDB
Position
Unknown
AA seq 202 aa
MYTLLSGLYKYLFQKDEYFVLILGLDNAGKTTYLEQTKTKFNRNYQGMNLSKITSTVGLN
IGKIDLGKVRLNFWDLGGQEELQSLWDKYYAESHAVIYIVDSSDTERIEESKAAFDKMIT
NNTLAGVPLMLLANKQDLDGCVKVSDMRTVFSPSQELIGHRDLHVSGVSALKGDGVNEGI
HWLVESIKKNSIQRPPTLKEIT
NT seq 609 nt   +upstreamnt  +downstreamnt
atgtacacattgctgtccggcctgtacaagtacttgttccagaaagatgaatactttgtc
ctcatcctgggacttgacaatgctggaaaaacgacatatctggagcagacgaagaccaag
ttcaacaggaactatcagggaatgaacctgtccaagatcaccagcacagttggtctcaat
attggaaagattgacttgggcaaagtgcgtctcaacttctgggatcttggaggtcaagag
gagcttcagtccctgtgggacaagtactacgctgagtcccatgcagtcatctacatcgtg
gactcctcagacaccgagaggatagaggaatccaaagcagcatttgataagatgatcacg
aacaacaccctggctggagtgcccctgatgttgctggccaacaagcaggacctcgatggc
tgtgtgaaggtgtccgacatgaggaccgtctttagccccagccaggagctgattggtcac
agggacctgcatgtgtcgggagtgtctgcactaaaaggggacggtgtcaatgagggaatc
cactggctggtggagagcatcaagaaaaacagtatacagagacccccaaccctgaaggag
attacctga

DBGET integrated database retrieval system