Haliotis rubra (blacklip abalone): 124263967
Help
Entry
124263967 CDS
T07967
Name
(RefSeq) ADP-ribosylation factor-related protein 1-like
KO
K07952
ADP-ribosylation factor related protein 1
Organism
hrj
Haliotis rubra (blacklip abalone)
Brite
KEGG Orthology (KO) [BR:
hrj00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
hrj04131
]
124263967
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:
hrj04031
]
124263967
Membrane trafficking [BR:
hrj04131
]
Endosome - Golgi transport
Arf GTPases and associated proteins
Arf GTPases
124263967
GTP-binding proteins [BR:
hrj04031
]
Small (monomeric) G-proteins
Arf/Sar Family
Arp
124263967
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Arf
G-alpha
Roc
Ras
Gtr1_RagA
SRPRB
MMR_HSR1
RXYLT1_N
HGTP_anticodon
Motif
Other DBs
NCBI-GeneID:
124263967
NCBI-ProteinID:
XP_046554652
LinkDB
All DBs
Position
Unknown
AA seq
202 aa
AA seq
DB search
MYTLLSGLYKYLFQKDEYFVLILGLDNAGKTTYLEQTKTKFNRNYQGMNLSKITSTVGLN
IGKIDLGKVRLNFWDLGGQEELQSLWDKYYAESHAVIYIVDSSDTERIEESKAAFDKMIT
NNTLAGVPLMLLANKQDLDGCVKVSDMRTVFSPSQELIGHRDLHVSGVSALKGDGVNEGI
HWLVESIKKNSIQRPPTLKEIT
NT seq
609 nt
NT seq
+upstream
nt +downstream
nt
atgtacacattgctgtccggcctgtacaagtacttgttccagaaagatgaatactttgtc
ctcatcctgggacttgacaatgctggaaaaacgacatatctggagcagacgaagaccaag
ttcaacaggaactatcagggaatgaacctgtccaagatcaccagcacagttggtctcaat
attggaaagattgacttgggcaaagtgcgtctcaacttctgggatcttggaggtcaagag
gagcttcagtccctgtgggacaagtactacgctgagtcccatgcagtcatctacatcgtg
gactcctcagacaccgagaggatagaggaatccaaagcagcatttgataagatgatcacg
aacaacaccctggctggagtgcccctgatgttgctggccaacaagcaggacctcgatggc
tgtgtgaaggtgtccgacatgaggaccgtctttagccccagccaggagctgattggtcac
agggacctgcatgtgtcgggagtgtctgcactaaaaggggacggtgtcaatgagggaatc
cactggctggtggagagcatcaagaaaaacagtatacagagacccccaaccctgaaggag
attacctga
DBGET
integrated database retrieval system