Haliotis rubra (blacklip abalone): 124284729 Help Entry 124284729         CDS       T07967                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism hrj  Haliotis rubra (blacklip abalone) Pathway hrj04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:hrj00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     124284729  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hrj01009]     124284729   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrj04131]     124284729    03036 Chromosome and associated proteins [BR:hrj03036]     124284729   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrj04147]     124284729 Protein phosphatases and associated proteins [BR:hrj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      124284729 Membrane trafficking [BR:hrj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     124284729 Chromosome and associated proteins [BR:hrj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      124284729 Exosome [BR:hrj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124284729 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg DUF5580 EF-hand_9 EH AIF-1 DUF7003 DUF7151 Motif Other DBs NCBI-GeneID:  124284729 NCBI-ProteinID:  XP_046576790 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MSPARVAALFTSLDTDKNSRVTLDEFLVAMPTIPPKERKCANLRRLFRSLDTNKDGVLSV DELSHVMASAEVPLSREETMQLIAQVDQDGDNQLNYEEFLELMESSSRR NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtcgccggcgagagttgcggctctcttcacatcgctggacactgacaaaaactccagg gtgacccttgacgagttcctggtcgccatgccaactataccgcccaaagaaaggaagtgc gcaaacctcagacgtctctttcgcagcctcgacacaaacaaagatggcgtcttgtcagtt gacgaactgtctcatgtcatggcatcagctgaagttcccctgagccgggaggaaacaatg cagcttatagctcaggtagaccaggacggagacaaccaactgaactatgaggagttcttg gagctgatggaatcgagtagtagaagatga

DBGET integrated database retrieval system