Haliotis rubra (blacklip abalone): 124291629 Help Entry 124291629         CDS       T07967                                  Name (RefSeq) ADP-ribosylation factor-like   KO K07937   ADP-ribosylation factor 1/2 Organism hrj  Haliotis rubra (blacklip abalone) Pathway hrj04144   Endocytosis Brite KEGG Orthology (KO) [BR:hrj00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124291629  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrj04131]     124291629   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrj04147]     124291629    04031 GTP-binding proteins [BR:hrj04031]     124291629 Membrane trafficking [BR:hrj04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     124291629   Arf GTPases and associated proteins    Arf GTPases     124291629  Endosome - Golgi transport     124291629 Exosome [BR:hrj04147]  Exosomal proteins   Proteins found in most exosomes    124291629 GTP-binding proteins [BR:hrj04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     124291629 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Ras Roc G-alpha NuiA_2 Gtr1_RagA Motif Other DBs NCBI-GeneID:  124291629 NCBI-ProteinID:  XP_046584637 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search WDVGGQDMIRPPWKQYFQNCSGILYVVDTNDRERFVESREELKNVIDSDEMRFVPVVVQA NQQDLPAATKLSEVVDALHLQKMTDRKWYIQGTCATTGEGLFEGLEELSRLVKDFKQSRR R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt tgggatgtggggggtcaggacatgattagacccccgtggaaacaatacttccagaactgc agcggtatcctgtacgtggttgacactaacgacagggagaggtttgtcgagtcacgggag gaactgaagaacgtcatcgacagcgacgagatgagatttgttcctgtcgtcgtccaggct aaccagcaagacttgccagctgccaccaagttatcggaagtagtggacgcccttcacctt cagaagatgacggaccggaagtggtacattcaggggacatgtgctacgaccggggagggt ctgtttgagggtctggaggaattgtccagattggtgaaagatttcaaacagagcaggagg cggtga

DBGET integrated database retrieval system