Halobaculum rubrum: K6T25_04455 Help Entry K6T25_04455       CDS       T07963                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hrm  Halobaculum rubrum Pathway hrm03010   Ribosome Brite KEGG Orthology (KO) [BR:hrm00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K6T25_04455   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K6T25_04455  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hrm03011]     K6T25_04455    04121 Ubiquitin system [BR:hrm04121]     K6T25_04455 Ribosome [BR:hrm03011]  Ribosomal proteins   Eukaryotes    Large subunit     K6T25_04455   Archaea     K6T25_04455 Ubiquitin system [BR:hrm04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K6T25_04455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR zf-CHY Zn_Ribbon_1 DHHC Motif Other DBs NCBI-ProteinID:  QZY00355 LinkDB All DBs Position 850046..850195 Genome browser AA seq 49 aa AA seqDB search MASFEAAERRTLDKLICMRCNARNPKRADNCRKCGYGNLRPKAKEPRTA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcatctttcgaggcggccgagcgccgtacgctcgataaactcatctgcatgcggtgc aacgcccggaacccgaagcgcgcggacaactgtcgcaagtgcggctacgggaacctccgc cccaaggcgaaggagcccagaaccgcctaa

DBGET integrated database retrieval system