Helobdella robusta: HELRODRAFT_128638 Help Entry HELRODRAFT_128638 CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K11251   histone H2A Organism hro  Helobdella robusta Pathway hro03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:hro00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     HELRODRAFT_128638  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hro03036]     HELRODRAFT_128638   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hro04147]     HELRODRAFT_128638 Chromosome and associated proteins [BR:hro03036]  Eukaryotic type   Nucleosome assembly factors    Histones     HELRODRAFT_128638 Exosome [BR:hro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HELRODRAFT_128638 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  20196096 NCBI-ProteinID:  XP_009023674 JGI:  Helro1_128638 UniProt:  T1EHP6 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MSGRGKGGKVKGKAKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVL NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgtccggaagaggtaaaggtggcaaagtcaaaggtaaggccaaaagcagatcgagtcga gcagggttgcagttcccggtaggaagaatccacagactgctgcgcaagggcaactacgct gaaagagtgggagccggcgcgcctgtctacctggcagcagtcatggagtatttagcagcc gaagttttg

DBGET integrated database retrieval system