Helobdella robusta: HELRODRAFT_147362 Help Entry HELRODRAFT_147362 CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K04374   cyclic AMP-dependent transcription factor ATF-4 Organism hro  Helobdella robusta Pathway hro04137   Mitophagy - animal hro04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     HELRODRAFT_147362  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     HELRODRAFT_147362  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:hro03000]     HELRODRAFT_147362 Transcription factors [BR:hro03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, CRE-BP/ATF     HELRODRAFT_147362 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 Seryl_tRNA_N bZIP_2 bZIP_Maf KLRAQ INO80F Motif Other DBs NCBI-GeneID:  20196895 NCBI-ProteinID:  XP_009023777 JGI:  Helro1_147362 UniProt:  T1EJZ5 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search EKKHRLKEQNKTAALKYRQKKRQEQNKFLDECSEIEEKNRQLKVRAEELQKEINYLKSLF AEI NT seq 189 nt NT seq  +upstreamnt  +downstreamnt gaaaagaaacatcgactgaaagaacagaacaagacggcagctttgaagtacaggcagaag aagaggcaggagcagaacaagtttttggatgaatgtagcgagatagaagaaaagaatcga cagctgaaggtcagggctgaagaacttcagaaggagatcaactatttgaagagtcttttt gctgagata

DBGET integrated database retrieval system