Helobdella robusta: HELRODRAFT_68212 Help Entry HELRODRAFT_68212  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K21872   periphilin-1 Organism hro  Helobdella robusta Brite KEGG Orthology (KO) [BR:hro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hro03036]     HELRODRAFT_68212 Chromosome and associated proteins [BR:hro03036]  Eukaryotic type   Heterochromatin formation proteins    Other heterochromatin formation proteins     HELRODRAFT_68212 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lge1 DUF3517 PDH_C DNA_alkylation VMAP-M1 Motif Other DBs NCBI-GeneID:  20214165 NCBI-ProteinID:  XP_009025200 JGI:  Helro1_68212 UniProt:  T1FZB7 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search KAYRQDCETFATVTKLLISKDPLLEERIQKSLRENLRDIGHRCVQELREFVDHIKNSDVE DVDDIVSRGIRDISDF NT seq 231 nt NT seq  +upstreamnt  +downstreamnt aaggcttacagacaagattgtgaaacgtttgcaactgttacgaagttattgataagtaag gatccgttgttagaagaacgcatccagaagagtcttcgtgaaaacctgagagacattgga cacagatgtgtgcaggaactgagagagtttgttgatcacattaagaacagcgatgttgaa gacgttgatgacattgttagtcgtggaatcagggatatatcagatttctaa

DBGET integrated database retrieval system