Helobdella robusta: HELRODRAFT_70817 Help Entry HELRODRAFT_70817  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism hro  Helobdella robusta Brite KEGG Orthology (KO) [BR:hro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hro03036]     HELRODRAFT_70817   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hro04147]     HELRODRAFT_70817 Chromosome and associated proteins [BR:hro03036]  Eukaryotic type   Nucleosome assembly factors    Histones     HELRODRAFT_70817 Exosome [BR:hro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HELRODRAFT_70817 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone IL7 Motif Other DBs NCBI-GeneID:  20214525 NCBI-ProteinID:  XP_009031174 JGI:  Helro1_70817 UniProt:  T1G0C7 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MPPQSASKDSRKTASKAKATRSMDKKHKRRQKKNYFIYIKKVLNQVHPGTGTRGKSMLIM LSFVNDIFE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgccaccacagtctgccagcaaggattctaggaagaccgccagcaaggcgaaagctact cgcagcatggacaagaagcacaaaagaaggcaaaagaaaaactattttatatacataaaa aaagtgctgaatcaagttcatccgggcacgggcactagaggcaaatccatgttaataatg ctttcgtttgtcaatgacatctttgaataa

DBGET integrated database retrieval system