Helobdella robusta: HELRODRAFT_71078 Help Entry HELRODRAFT_71078  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism hro  Helobdella robusta Pathway hro04068   FoxO signaling pathway hro04136   Autophagy - other hro04137   Mitophagy - animal hro04140   Autophagy - animal hro04145   Phagocytosis hro04156   Integrated stress response (ISR) signaling pathway Brite KEGG Orthology (KO) [BR:hro00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     HELRODRAFT_71078  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     HELRODRAFT_71078    04140 Autophagy - animal     HELRODRAFT_71078    04136 Autophagy - other     HELRODRAFT_71078    04137 Mitophagy - animal     HELRODRAFT_71078   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     HELRODRAFT_71078  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hro04131]     HELRODRAFT_71078    04121 Ubiquitin system [BR:hro04121]     HELRODRAFT_71078    03029 Mitochondrial biogenesis [BR:hro03029]     HELRODRAFT_71078 Membrane trafficking [BR:hro04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     HELRODRAFT_71078 Ubiquitin system [BR:hro04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    HELRODRAFT_71078 Mitochondrial biogenesis [BR:hro03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     HELRODRAFT_71078 SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 NRG4_TM Motif Other DBs NCBI-GeneID:  20214563 NCBI-ProteinID:  XP_009031212 JGI:  Helro1_71078 UniProt:  T1G0G5 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MRWEYKEENSFDKRKSEGDKIRKKYPDRVPVIVEKAPKARVEDLDKKKYLVPAELTVGQF YFLIRKRIHLKPEEALFFFVNNIIPPTSTTMGQLYQEHHEEDAFLYIAYSDESVYGN NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcgctgggaatataaagaagagaactccttcgataagaggaaatcagagggcgataag attcgaaagaaatatcctgatcgtgttccagttattgtagagaaagccccaaaagccaga gttgaagaccttgacaaaaagaaatatttggtcccggctgagctgacagttggccagttc tactttttaattcgaaaacgaatccacttgaagcctgaagaagctctgtttttttttgtg aacaatatcatcccgccaaccagcacaaccatgggacaactctaccaggaacatcacgaa gaagatgcattcctctacatagcatacagtgatgaaagtgtttatggcaactaa

DBGET integrated database retrieval system