Helobdella robusta: HELRODRAFT_77283 Help Entry HELRODRAFT_77283  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism hro  Helobdella robusta Pathway hro03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hro00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     HELRODRAFT_77283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hro03036]     HELRODRAFT_77283    03400 DNA repair and recombination proteins [BR:hro03400]     HELRODRAFT_77283 Chromosome and associated proteins [BR:hro03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      HELRODRAFT_77283 DNA repair and recombination proteins [BR:hro03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      HELRODRAFT_77283 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-31kDa Histone TAF Motif Other DBs NCBI-GeneID:  20215404 NCBI-ProteinID:  XP_009016159 JGI:  Helro1_77283 UniProt:  T1G2V6 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search QRLKAAIYYTTSEICTVLGSKADITINNKFVAALTETTVRYLECLGRDLELFARHAKRTQ ISVDDVLLTARKSQELVITKFLFSSINHLFCFQIL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt cagcgattgaaagctgcaatatattatacaacctcagaaatctgcactgttcttggaagc aaggcggatataacaatcaataacaaatttgtggcagctctcactgagactactgtcaga tacttagaatgccttggcagggatttagaactgtttgcaaggcatgctaaacgaacccaa atcagtgtcgatgatgtcttgttgacagccagaaaatcacaagaattggttattacaaaa tttttattttcctctataaatcatttattctgctttcaaatattgtaa

DBGET integrated database retrieval system