Helobdella robusta: HELRODRAFT_79110 Help Entry HELRODRAFT_79110  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K11253   histone H3 Organism hro  Helobdella robusta Brite KEGG Orthology (KO) [BR:hro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hro03036]     HELRODRAFT_79110   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hro04147]     HELRODRAFT_79110 Chromosome and associated proteins [BR:hro03036]  Eukaryotic type   Nucleosome assembly factors    Histones     HELRODRAFT_79110 Exosome [BR:hro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HELRODRAFT_79110 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  20215649 NCBI-ProteinID:  XP_009017720 JGI:  Helro1_79110 UniProt:  T1G3K1 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcaagaaccaagcagacggctcgcaagtcaaccggtggcaaggcacctcgcaagcag ctggccacgaaggctgccagaaaaagcgctccggctaccggaggtgtcaaaaaacctcat cgttacaggcctggtacagtggctctcagagaaatcaggcgctaccagaaaagcaccgag ctgctcatcagaaaactgccctttcaaagactcgttcgtgagatagctcaggatttcaag

DBGET integrated database retrieval system