Helobdella robusta: HELRODRAFT_92708 Help Entry HELRODRAFT_92708  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism hro  Helobdella robusta Brite KEGG Orthology (KO) [BR:hro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hro03036]     HELRODRAFT_92708   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hro04147]     HELRODRAFT_92708 Chromosome and associated proteins [BR:hro03036]  Eukaryotic type   Nucleosome assembly factors    Histones     HELRODRAFT_92708 Exosome [BR:hro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HELRODRAFT_92708 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF LonB_AAA-LID TFIID_20kDa DUF1931 Motif Other DBs NCBI-GeneID:  20217396 NCBI-ProteinID:  XP_009022421 JGI:  Helro1_92708 UniProt:  T1G3M0 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY TSSK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaattcgttcgtcaatgacatctttgaacgaatcgcagccgaagcttctcgcctcgcc cactacaacaagagatccacaatcaccagcagagaaatccagacggccgtcaggcttctg ttgcccggcgagttggccaagcacgccgtcagcgaaggcaccaaggccgtcaccaagtac accagctcaaagtaa

DBGET integrated database retrieval system