Helobdella robusta: HELRODRAFT_92790 Help Entry HELRODRAFT_92790  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism hro  Helobdella robusta Pathway hro03020   RNA polymerase hro03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hro00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HELRODRAFT_92790   09124 Replication and repair    03420 Nucleotide excision repair     HELRODRAFT_92790  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:hro03021]     HELRODRAFT_92790    03400 DNA repair and recombination proteins [BR:hro03400]     HELRODRAFT_92790 Transcription machinery [BR:hro03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      HELRODRAFT_92790   RNA polymerase III system    RNA polymerase III      HELRODRAFT_92790   RNA polymerase I system    RNA polymerase I      HELRODRAFT_92790 DNA repair and recombination proteins [BR:hro03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       HELRODRAFT_92790 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  20217407 NCBI-ProteinID:  XP_009026587 JGI:  Helro1_92790 UniProt:  T1FXD3 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MIIPIRCFTCGKVIGNLWNKYLRLLEADYTECEALDELGLKRYCCRRMLLSHVDIIEKLL NYAPLDP NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgattattccgatcagatgtttcacgtgtggaaaggttattggaaatttatggaacaaa tacttgagactattagaggctgattacacagaatgtgaagctctggatgaattgggactg aagaggtactgctgcagaagaatgctgctcagtcacgtcgacatcatcgagaagttgctc aattatgccccactggatccatga

DBGET integrated database retrieval system