Hirundo rustica (Barn swallow): 120752146 Help Entry 120752146         CDS       T09369                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt03082   ATP-dependent chromatin remodeling hrt04217   Necroptosis Brite KEGG Orthology (KO) [BR:hrt00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120752146  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120752146  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hrt03036]     120752146   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrt04147]     120752146 Chromosome and associated proteins [BR:hrt03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120752146 Exosome [BR:hrt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120752146 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120752146 NCBI-ProteinID:  XP_039918765 LinkDB All DBs Position 4:complement(49307674..49308968) Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcgggaagcagggcgggaaggcgcgcgccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgacgatcgcgcagggcggcgtgctgcccaacatccaggccgtgctgctgcccaagaag accgagagccacaaagccaagagcaaataa

DBGET integrated database retrieval system