Hirundo rustica (Barn swallow): 120752974 Help Entry 120752974         CDS       T09369                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04060   Cytokine-cytokine receptor interaction hrt04218   Cellular senescence hrt04620   Toll-like receptor signaling pathway hrt04621   NOD-like receptor signaling pathway hrt04622   RIG-I-like receptor signaling pathway hrt05132   Salmonella infection hrt05164   Influenza A Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120752974  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120752974  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120752974    04621 NOD-like receptor signaling pathway     120752974    04622 RIG-I-like receptor signaling pathway     120752974  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120752974   09171 Infectious disease: bacterial    05132 Salmonella infection     120752974  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hrt04052]     120752974    00536 Glycosaminoglycan binding proteins [BR:hrt00536]     120752974 Cytokines and neuropeptides [BR:hrt04052]  Cytokines   Chemokines    120752974 Glycosaminoglycan binding proteins [BR:hrt00536]  Heparan sulfate / Heparin   Chemokines    120752974 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain bPH_6 Motif Other DBs NCBI-GeneID:  120752974 NCBI-ProteinID:  XP_039920756 LinkDB All DBs Position 5:60910789..60913311 Genome browser AA seq 103 aa AA seqDB search MNGKLVAVLALFLISAAVSQGRTLARMATELRCQCIATHSRFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKAILARAQQNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaactcgtagctgtcctggctcttttcctgatctcagcagctgtgtctcaa ggcaggactctggcaaggatggcaaccgagctccggtgccagtgcatcgccactcactcc aggttcattcccccgaaatccatccaagatgtgaagctgacacagagcggcccccactgc aagaatgttgaagtcatagctactctgaaggacggcagagaggtgtgcttggagcccact gctccctgggtacagctgattgtaaaggcaattttggccagggctcaacaaaattctgac tctcctctctaa

DBGET integrated database retrieval system