Hirundo rustica (Barn swallow): 120753590 Help Entry 120753590         CDS       T09369                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04010   MAPK signaling pathway hrt04012   ErbB signaling pathway hrt04068   FoxO signaling pathway hrt04137   Mitophagy - animal hrt04140   Autophagy - animal hrt04144   Endocytosis hrt04150   mTOR signaling pathway hrt04210   Apoptosis hrt04218   Cellular senescence hrt04370   VEGF signaling pathway hrt04371   Apelin signaling pathway hrt04510   Focal adhesion hrt04540   Gap junction hrt04625   C-type lectin receptor signaling pathway hrt04810   Regulation of actin cytoskeleton hrt04910   Insulin signaling pathway hrt04912   GnRH signaling pathway hrt04916   Melanogenesis hrt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120753590 (HRAS)    04012 ErbB signaling pathway     120753590 (HRAS)    04370 VEGF signaling pathway     120753590 (HRAS)    04371 Apelin signaling pathway     120753590 (HRAS)    04068 FoxO signaling pathway     120753590 (HRAS)    04150 mTOR signaling pathway     120753590 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120753590 (HRAS)    04140 Autophagy - animal     120753590 (HRAS)    04137 Mitophagy - animal     120753590 (HRAS)   09143 Cell growth and death    04210 Apoptosis     120753590 (HRAS)    04218 Cellular senescence     120753590 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120753590 (HRAS)    04540 Gap junction     120753590 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120753590 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120753590 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120753590 (HRAS)    04912 GnRH signaling pathway     120753590 (HRAS)    04916 Melanogenesis     120753590 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120753590 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrt04131]     120753590 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrt04147]     120753590 (HRAS)    04031 GTP-binding proteins [BR:hrt04031]     120753590 (HRAS) Membrane trafficking [BR:hrt04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120753590 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120753590 (HRAS) Exosome [BR:hrt04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120753590 (HRAS)   Exosomal proteins of colorectal cancer cells    120753590 (HRAS) GTP-binding proteins [BR:hrt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120753590 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  120753590 NCBI-ProteinID:  XP_039921847 LinkDB All DBs Position 6:complement(45494405..45534274) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgacg atacagctaattcagaaccattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtagtcatcgatggagagacctgtttgttagacatcttggacactgcaggg caggaggagtacagtgccatgagagaccagtacatgagaacaggggaaggattcctgtgt gtcttcgccatcaacaacaccaagtcctttgaagatatccaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtggggaataaatgcgacctc cctgcgcgaacagtggagacccggcaagcgcaggacctggcccggagctacgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaggatgccttctacactttggtg cgggagatccggcagcataagctgcgcaagctgaatcccccggatgagagcggccccggc tgcatgaactgtaaatgtgtggtatcgtga

DBGET integrated database retrieval system