Hirundo rustica (Barn swallow): 120754077 Help Entry 120754077         CDS       T09369                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04010   MAPK signaling pathway hrt04137   Mitophagy - animal hrt04140   Autophagy - animal hrt04218   Cellular senescence hrt04371   Apelin signaling pathway hrt04625   C-type lectin receptor signaling pathway hrt04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120754077 (RRAS2)    04371 Apelin signaling pathway     120754077 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120754077 (RRAS2)    04137 Mitophagy - animal     120754077 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     120754077 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120754077 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120754077 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrt04147]     120754077 (RRAS2)    04031 GTP-binding proteins [BR:hrt04031]     120754077 (RRAS2) Exosome [BR:hrt04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120754077 (RRAS2)   Exosomal proteins of bladder cancer cells    120754077 (RRAS2) GTP-binding proteins [BR:hrt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120754077 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  120754077 NCBI-ProteinID:  XP_039923178 LinkDB All DBs Position 6:51713923..51757017 Genome browser AA seq 203 aa AA seqDB search MAAGCRDGPGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERA ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLDHQRQVTQEEGQQLARQLKVMYMEASAKIRLNVDQAFHELVRVIRKFQEQ ECPPSPEPTRKEKDKKGCHCVIF NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggccgcgggctgcagggacggcccgggacaggagaagtaccggctggtggtggtgggc ggcggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcttactttgttacg gattatgacccaaccattgaggattcctacaccaaacaatgtgtgatagacgagagagcc gcacgcttggacattctggatacagcaggacaagaagaatttggagccatgcgtgagcag tatatgaggacaggggaaggttttctgcttgttttctcagtcacggatagaggaagcttt gaagaaatctataagtttcagcgacagattcttagagtgaaagatcgcgacgagtttcca atgattctcgttggtaataaagcagatctggaccaccaaagacaggtgacgcaagaggaa ggccagcagctggcacggcaacttaaagtaatgtacatggaagcctcagcaaaaatcaga ttgaatgtagaccaagcttttcatgaacttgtcagagttataaggaaatttcaggaacaa gagtgccctccttcaccagagccaacacggaaagaaaaagacaagaaaggctgccattgt gttattttctga

DBGET integrated database retrieval system